Product Description
Recombinant Human CD59 glycoprotein (CD59) is available at Gentaur for Next week Delivery.
Gene Name: CD59
Alternative Names : 1F5 antigen20KDA homologous restriction factor;HRF-20;HRF20MAC-inhibitory protein;MAC-IPMEM43 antigen;Membrane attack complex inhibition factor;MACIFMembrane inhibitor of reactive lysis;MIRLProtectin; CD59
Expression Region : 26-102aa
AA Sequence : LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 11 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Potent inhibitor of the complent mbrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complents of the assbling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.The soluble form from urine retains its specific complent binding activity, but exhibits greatly reduced ability to inhibit MAC assbly on cell mbranes.
Function : Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; FUNCTION
Involvement in disease : Hemolytic anemia, CD59-mediated, with or without polyneuropathy (HACD59)
Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Secreted
Protein Families :
Tissue Specificity :
Paythway : Complementandcoagulationcascades
Uniprot ID : P13987
Euro
British Pound
US Dollar