Recombinant Human CD81 antigen (CD81), partial

Product Description

Recombinant Human CD81 antigen (CD81), partial is available at Gentaur for Next week Delivery.

Gene Name: CD81

Alternative Names : 26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28;Tspan-28; CD81

Expression Region : 113-201aa

AA Sequence : FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 11.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-KDA Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.

Function : May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.; FUNCTION

Involvement in disease : Immunodeficiency, common variable, 6 (CVID6)

Subcellular location : Basolateral cell membrane, Multi-pass membrane protein

Protein Families : Tetraspanin (TM4SF) family

Tissue Specificity : Hematolymphoid, neuroectodermal and mesenchymal tumor cell lines.

Paythway : Bcellreceptorsignalingpathway

Uniprot ID : P60033