Product Description
Recombinant Human CDKN2AIP N-terminal-like protein (CDKN2AIPNL) is available at Gentaur for Next week Delivery.
Gene Name: CDKN2AIPNL
Alternative Names : CDKN2A-interacting protein N-terminal-like protein
Expression Region : 1-116aa
AA Sequence : MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMVWANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 17.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families : CARF family
Tissue Specificity :
Paythway :
Uniprot ID : Q96HQ2