Product Description
Recombinant Human Cell surface hyaluronidase (TMEM2), partial is available at Gentaur for Next week Delivery.
Gene Name: TMEM2
Alternative Names : Transmembrane protein 2 (KIAA1412)
Expression Region : 104-250aa
AA Sequence : SSKYAPDENCPDQNPRLRNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYILIQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASWTLLARTLNSS
Sequence Info : Partial
Tag Info : N-terminal 10xHis-tagged
Theoretical MW : 21.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments. Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of extracellular hyaluronan, thereby regulating VEGF signaling. Is very specific to hyaluronan; not able to cleave chondroitin sulfate or dermatan sulfate
Function : Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate-size hyaluronan of approximately 5 kDa fragments
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type II membrane protein
Protein Families : TMEM2 family
Tissue Specificity : Widely expressed.
Paythway :
Uniprot ID : Q9UHN6