Recombinant Human Cellular retinoic acid-binding protein 1 (CRABP1)

Product Description

Recombinant Human Cellular retinoic acid-binding protein 1 (CRABP1) is available at Gentaur for Next week Delivery.

Gene Name: CRABP1

Alternative Names : Cellular retinoic acid-binding protein I;CRABP-I

Expression Region : 2-137aa

AA Sequence : PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 42.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.

Function : Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Calycin superfamily, Fatty-acid binding protein (FABP) family

Tissue Specificity :

Paythway :

Uniprot ID : P29762