Recombinant Human Cementoblastoma-derived protein 1 (CEMP1)

Product Description

Recombinant Human Cementoblastoma-derived protein 1 (CEMP1) is available at Gentaur for Next week Delivery.

Gene Name: CEMP1

Alternative Names : Cementum protein 1Cementum protein 23;CP-23

Expression Region : 1-247aa

AA Sequence : MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 28 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : May play a role in development of the periodontium which surrounds and supports the teeth by promoting the differentiation of multi-potent cells from the periodontal ligament into cementoblasts to form the cementum

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families :

Tissue Specificity : Expressed by cementoblasts, a subpopulation of periodontal ligament cells and cells located around vessels in periodontium (at protein level).

Paythway :

Uniprot ID : Q6PRD7