Recombinant Human Centrin-1 (CETN1)

Product Description

Recombinant Human Centrin-1 (CETN1) is available at Gentaur for Next week Delivery.

Gene Name: CETN1

Alternative Names : Caltractin isoform 2

Expression Region : 1-172aa

AA Sequence : MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 46.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a fundamental role in microtubule-organizing center structure and function.

Function : Plays a fundamental role in microtubule-organizing center structure and function.

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton, microtubule organizing center, centrosome

Protein Families : Centrin family

Tissue Specificity :

Paythway :

Uniprot ID : Q12798