Product Description
Recombinant Human Centrin-3 (CETN3) is available at Gentaur for Next week Delivery.
Gene Name: CETN3
Alternative Names :
Expression Region : 1-167aa
AA Sequence : MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 46.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Tags & Cell Markers
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Plays a fundamental role in microtubule-organizing center structure and function. Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, DSS1, and either centrin CETN2 or CETN3. The TREX-2 complex functions in docking export-competent ribonucleoprotein particles (mRNPs) to the nuclear entrance of the nuclear pore complex (nuclear basket). TREX-2 participates in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery
Function : Plays a fundamental role in microtubule-organizing center structure and function.; FUNCTION
Involvement in disease :
Subcellular location : Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Nucleus, nucleolus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole
Protein Families : Centrin family
Tissue Specificity :
Paythway :
Uniprot ID : O15182
Euro
British Pound
US Dollar