Recombinant Human Chymotrypsin-like elastase family member 3A (CELA3A)

Product Description

Recombinant Human Chymotrypsin-like elastase family member 3A (CELA3A) is available at Gentaur for Next week Delivery.

Gene Name: CELA3A

Alternative Names : Elastase IIIA;Elastase-3A;Protease E

Expression Region : 29-270aa

AA Sequence : VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 42.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Efficient protease with alanine specificity but only little elastolytic activity.

Function : Efficient protease with alanine specificity but only little elastolytic activity.

Involvement in disease :

Subcellular location :

Protein Families : Peptidase S1 family, Elastase subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P09093