Product Description
Recombinant Human Chymotrypsin-like elastase family member 3A (CELA3A) is available at Gentaur for Next week Delivery.
Gene Name: CELA3A
Alternative Names : Elastase IIIA;Elastase-3A;Protease E
Expression Region : 29-270aa
AA Sequence : VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASH
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 42.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Efficient protease with alanine specificity but only little elastolytic activity.
Function : Efficient protease with alanine specificity but only little elastolytic activity.
Involvement in disease :
Subcellular location :
Protein Families : Peptidase S1 family, Elastase subfamily
Tissue Specificity :
Paythway :
Uniprot ID : P09093
Euro
British Pound
US Dollar