Recombinant Human Ciliary neurotrophic factor (CNTF), partial

Product Description

Recombinant Human Ciliary neurotrophic factor (CNTF), partial is available at Gentaur for Next week Delivery.

Gene Name: CNTF

Alternative Names :

Expression Region : 4-196aa

AA Sequence : TEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIAN

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 26.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : CNTF is a survival factor for various neuronal cell types. Ses to prevent the degeneration of motor axons after axotomy.

Function : CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : CNTF family

Tissue Specificity : Nervous system.

Paythway : Jak-STATsignalingpathway

Uniprot ID : P26441