Recombinant Human Clathrin heavy chain 2 (CLTCL1), partial

Product Description

Recombinant Human Clathrin heavy chain 2 (CLTCL1), partial is available at Gentaur for Next week Delivery.

Gene Name: CLTCL1

Alternative Names : Clathrin heavy chain on chromosome 22;CLH-22

Expression Region : 1423-1566aa

AA Sequence : LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 18.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma mbrane or to the trans-Golgi network .

Function : Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network (By similarity).

Involvement in disease :

Subcellular location : Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, coated pit, Peripheral membrane protein, Cytoplasmic side

Protein Families : Clathrin heavy chain family

Tissue Specificity : Maximal levels in skeletal muscle. High levels in heart and testis. Low expression detected in all other tissues.

Paythway : Endocytosis

Uniprot ID : P53675