Recombinant Human Clathrin light chain A (CLTA)

Product Description

Recombinant Human Clathrin light chain A (CLTA) is available at Gentaur for Next week Delivery.

Gene Name: CLTA

Alternative Names :

Expression Region : 1-218aa

AA Sequence : MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH

Sequence Info : Full Length of Isoform Non-brain

Tag Info : N-terminal GST-tagged

Theoretical MW : 50.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge

Function : Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Acts as component of the TACC3/ch-TOG/clathrin complex proposed to contribute to stabilization of kinetochore fibers of the mitotic spindle by acting as inter-microtubule bridge

Involvement in disease :

Subcellular location : Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side, Membrane, coated pit, Peripheral membrane protein, Cytoplasmic side, Cytoplasm, cytoskeleton, spindle

Protein Families : Clathrin light chain family

Tissue Specificity :

Paythway : Endocytosis

Uniprot ID : P09496