Recombinant Human Claudin-3 (CLDN3), partial

Product Description

Recombinant Human Claudin-3 (CLDN3), partial is available at Gentaur for Next week Delivery.

Gene Name: CLDN3

Alternative Names : Clostridium perfringens enterotoxin receptor 2

Expression Region : 30-80aa

AA Sequence : RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR

Sequence Info : Partial

Tag Info : N-terminal 6xHis-B2M-tagged

Theoretical MW : 19.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Function : Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Involvement in disease : CLDN3 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.

Subcellular location : Cell junction, tight junction, Cell membrane, Multi-pass membrane protein

Protein Families : Claudin family

Tissue Specificity :

Paythway :

Uniprot ID : O15551