Recombinant Human Claudin-6 (CLDN6), partial

Product Description

Recombinant Human Claudin-6 (CLDN6), partial is available at Gentaur for Next week Delivery.

Gene Name: CLDN6

Alternative Names : Skullin

Expression Region : 1-82aa

AA Sequence : MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 24.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a major role in tight junction-specific obliteration of the intercellular space (By similarity). May act as a coreceptor for HCV entry into hepatic cells.

Function : Plays a major role in tight junction-specific obliteration of the intercellular space.

Involvement in disease :

Subcellular location : Cell junction, tight junction, Cell membrane, Multi-pass membrane protein

Protein Families : Claudin family

Tissue Specificity : Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines.

Paythway :

Uniprot ID : P56747