Product Description
Recombinant Human CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase (ST8SIA4) is available at Gentaur for Next week Delivery.
Gene Name: ST8SIA4
Alternative Names : Alpha-2,8-sialyltransferase 8DPolysialyltransferase-1Sialyltransferase 8D;SIAT8-DSialyltransferase St8Sia IV;ST8SiaIV
Expression Region : 21-168aa
AA Sequence : KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
Sequence Info : Full Length of Isoform 2
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 32.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Tags & Cell Markers
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the bryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.
Function : Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the embryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells.
Involvement in disease :
Subcellular location : Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families : Glycosyltransferase 29 family
Tissue Specificity : Highly expressed in fetal brain, lung and kidney and in adult heart, spleen and thymus. Present to a lesser extent in adult brain, placenta, lung, large and small intestine and peripheral blood leukocytes.
Paythway :
Uniprot ID : Q92187
Euro
British Pound
US Dollar