Product Description
Recombinant Human CMRF35-like molecule 1 (CD300LF), partial is available at Gentaur for Next week Delivery.
Gene Name: CD300LF
Alternative Names : CD300 antigen-like family member FImmune receptor expressed on myeloid cells 1;IREM-1Immunoglobulin superfamily member 13;IgSF13NK inhibitory receptor; CD300f
Expression Region : 20-156aa
AA Sequence : TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 17.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation.
Function : Acts as an inhibitory receptor for myeloid cells and mast cells
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type I membrane protein
Protein Families : CD300 family
Tissue Specificity : Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells.
Paythway :
Uniprot ID : Q8TDQ1
Euro
British Pound
US Dollar