Product Description
Recombinant Human Coagulation factor XI (F11), partial is available at Gentaur for Next week Delivery.
Gene Name: F11
Alternative Names : Plasma thromboplastin antecedent Short name:PTA Cleaved into the following 2 chains: Coagulation factor XIa heavy chain Coagulation factor XIa light chain
Expression Region : 19-387aa
AA Sequence : ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 45.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.
Function : Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.
Involvement in disease : Factor XI deficiency (FA11D)
Subcellular location : Secreted
Protein Families : Peptidase S1 family, Plasma kallikrein subfamily
Tissue Specificity : Isoform 2 is produced by platelets and megakaryocytes but absent from other blood cells.
Paythway : Complementandcoagulationcascades
Uniprot ID : P03951
Euro
British Pound
US Dollar