Recombinant Human Coagulation factor XI (F11), partial

Product Description

Recombinant Human Coagulation factor XI (F11), partial is available at Gentaur for Next week Delivery.

Gene Name: F11

Alternative Names : Plasma thromboplastin antecedent Short name:PTA Cleaved into the following 2 chains: Coagulation factor XIa heavy chain Coagulation factor XIa light chain

Expression Region : 19-387aa

AA Sequence : ECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPR

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 45.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.

Function : Factor XI triggers the middle phase of the intrinsic pathway of blood coagulation by activating factor IX.

Involvement in disease : Factor XI deficiency (FA11D)

Subcellular location : Secreted

Protein Families : Peptidase S1 family, Plasma kallikrein subfamily

Tissue Specificity : Isoform 2 is produced by platelets and megakaryocytes but absent from other blood cells.

Paythway : Complementandcoagulationcascades

Uniprot ID : P03951