Recombinant Human Cofilin-2 (CFL2)

Product Description

Recombinant Human Cofilin-2 (CFL2) is available at Gentaur for Next week Delivery.

Gene Name: CFL2

Alternative Names : Cofilin, muscle isoform

Expression Region : 1-166aa

AA Sequence : MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 45.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere

Function : Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3

Involvement in disease : Nemaline myopathy 7 (NEM7)

Subcellular location : Nucleus matrix, Cytoplasm, cytoskeleton

Protein Families : Actin-binding proteins ADF family

Tissue Specificity : Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.

Paythway : Regulationofactincytoskeleton

Uniprot ID : Q9Y281