Product Description
Recombinant Human Collagen alpha-1 (XI) chain, partial is available at Gentaur for Next week Delivery.
Gene Name: XI
Alternative Names :
Expression Region : 532-699aa
AA Sequence : GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 42.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.
Function : May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.
Involvement in disease : Stickler syndrome 2 (STL2); Marshall syndrome (MRSHS); Fibrochondrogenesis 1 (FBCG1)
Subcellular location : Secreted, extracellular space, extracellular matrix
Protein Families : Fibrillar collagen family
Tissue Specificity : Cartilage, placenta and some tumor or virally transformed cell lines. Isoforms using exon IIA or IIB are found in the cartilage while isoforms using only exon IIB are found in the tendon.
Paythway :
Uniprot ID : P12107
Euro
British Pound
US Dollar