Recombinant Human Collagen alpha-1 (XI) chain, partial

Product Description

Recombinant Human Collagen alpha-1 (XI) chain, partial is available at Gentaur for Next week Delivery.

Gene Name: XI

Alternative Names :

Expression Region : 532-699aa

AA Sequence : GPMGLTGRPGPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTPGAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQ

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 42.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.

Function : May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.

Involvement in disease : Stickler syndrome 2 (STL2); Marshall syndrome (MRSHS); Fibrochondrogenesis 1 (FBCG1)

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families : Fibrillar collagen family

Tissue Specificity : Cartilage, placenta and some tumor or virally transformed cell lines. Isoforms using exon IIA or IIB are found in the cartilage while isoforms using only exon IIB are found in the tendon.

Paythway :

Uniprot ID : P12107