Recombinant Human COMM domain-containing protein 4 (COMMD4), partial

Product Description

Recombinant Human COMM domain-containing protein 4 (COMMD4), partial is available at Gentaur for Next week Delivery.

Gene Name: COMMD4

Alternative Names :

Expression Region : 1-195aa

AA Sequence : MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 48.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes . Down-regulates activation of NF-kappa-B.

Function : May modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families :

Tissue Specificity : Ubiquitous.

Paythway :

Uniprot ID : Q9H0A8