Recombinant Human Complement receptor type 1 (CR1), partial

Product Description

Recombinant Human Complement receptor type 1 (CR1), partial is available at Gentaur for Next week Delivery.

Gene Name: CR1

Alternative Names : C3b/C4b receptor CD_antigen: CD35

Expression Region : 41-234aa

AA Sequence : GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 48.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mediates cellular binding of particles and immune complexes that have activated complement. (Microbial infection) Acts as a receptor for Epstein-Barr virus.

Function : Mediates cellular binding of particles and immune complexes that have activated complement.; FUNCTION

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : Receptors of complement activation (RCA) family

Tissue Specificity : Present on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells.

Paythway : Complementandcoagulationcascades

Uniprot ID : P17927