Product Description
Recombinant Human Complement receptor type 1 (CR1), partial is available at Gentaur for Next week Delivery.
Gene Name: CR1
Alternative Names : C3b/C4b receptor CD_antigen: CD35
Expression Region : 41-234aa
AA Sequence : GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 48.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Mediates cellular binding of particles and immune complexes that have activated complement. (Microbial infection) Acts as a receptor for Epstein-Barr virus.
Function : Mediates cellular binding of particles and immune complexes that have activated complement.; FUNCTION
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families : Receptors of complement activation (RCA) family
Tissue Specificity : Present on erythrocytes, leukocytes, glomerular podocytes, and splenic follicular dendritic cells.
Paythway : Complementandcoagulationcascades
Uniprot ID : P17927
Euro
British Pound
US Dollar