Euro
British Pound
US Dollar
Product Description
Recombinant Human Connector enhancer of kinase suppressor of ras 2 (CNKSR2), partial is available at Gentaur for Next week Delivery.
Gene Name: CNKSR2
Alternative Names : CNK homolog protein 2;CNK2
Expression Region : 650-800aa
AA Sequence : AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 19.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May function as an adapter protein or regulator of Ras signaling pathways.
Function : May function as an adapter protein or regulator of Ras signaling pathways.
Involvement in disease :
Subcellular location : Cytoplasm, Membrane, Peripheral membrane protein
Protein Families : CNKSR family
Tissue Specificity :
Paythway :
Uniprot ID : Q8WXI2
