Recombinant Human Craniofacial development protein 1 (CFDP1)

Product Description

Recombinant Human Craniofacial development protein 1 (CFDP1) is available at Gentaur for Next week Delivery.

Gene Name: CFDP1

Alternative Names : Bucentaur

Expression Region : 1-299aa

AA Sequence : MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 60.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Stem Cells

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role during embryogenesis

Function : May play a role during embryogenesis.

Involvement in disease :

Subcellular location : Chromosome, centromere, kinetochore

Protein Families :

Tissue Specificity : Ubiquitous.

Paythway :

Uniprot ID : Q9UEE9