Product Description
Recombinant Human Craniofacial development protein 1 (CFDP1) is available at Gentaur for Next week Delivery.
Gene Name: CFDP1
Alternative Names : Bucentaur
Expression Region : 1-299aa
AA Sequence : MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSLEEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETEETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 60.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Stem Cells
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play a role during embryogenesis
Function : May play a role during embryogenesis.
Involvement in disease :
Subcellular location : Chromosome, centromere, kinetochore
Protein Families :
Tissue Specificity : Ubiquitous.
Paythway :
Uniprot ID : Q9UEE9
Euro
British Pound
US Dollar