Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3)

Product Description

Recombinant Human Cyclic AMP-dependent transcription factor ATF-3 (ATF3) is available at Gentaur for Next week Delivery.

Gene Name: ATF3

Alternative Names : Activating transcription factor 3

Expression Region : 1-181aa

AA Sequence : MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 26.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter. Isoform 2 activates transcription presumably by sequestering inhibitory cofactors away from the promoters.

Function : This protein binds the cAMP response element (CRE) (consensus

Involvement in disease :

Subcellular location : Nucleus

Protein Families : BZIP family, ATF subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P18847