Euro
British Pound
US Dollar
Product Description
Recombinant Human Cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) is available at Gentaur for Next week Delivery.
Gene Name: CDK2AP1
Alternative Names : Deleted in oral cancer 1;DOC-1;Putative oral cancer suppressor
Expression Region : 1-115aa
AA Sequence : MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 39.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Cycle
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : specific inhibitor of the cell-cycle kinase CDK2.
Function : specific inhibitor of the cell-cycle kinase CDK2.
Involvement in disease :
Subcellular location :
Protein Families : CDK2AP family
Tissue Specificity :
Paythway :
Uniprot ID : O14519
