Recombinant Human Cyclin-dependent kinase 4 inhibitor D (CDKN2D)

Product Description

Recombinant Human Cyclin-dependent kinase 4 inhibitor D (CDKN2D) is available at Gentaur for Next week Delivery.

Gene Name: CDKN2D

Alternative Names : p19-INK4d

Expression Region : 1-166aa

AA Sequence : MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 44.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interacts strongly with CDK4 and CDK6 and inhibits them

Function : Interacts strongly with CDK4 and CDK6 and inhibits them.

Involvement in disease :

Subcellular location : Nucleus, Cytoplasm

Protein Families : CDKN2 cyclin-dependent kinase inhibitor family

Tissue Specificity :

Paythway : Cellcycle

Uniprot ID : P55273