Recombinant Human Cyclin-dependent kinase inhibitor 3 (CDKN3)

Product Description

Recombinant Human Cyclin-dependent kinase inhibitor 3 (CDKN3) is available at Gentaur for Next week Delivery.

Gene Name: CDKN3

Alternative Names : CDK2-associated dual-specificity phosphatase Cyclin-dependent kinase interactor 1 Cyclin-dependent kinase-interacting protein 2 Kinase-associated phosphatase

Expression Region : 1-212aa

AA Sequence : MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 25.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.

Function : May play a role in cell cycle regulation. Dual specificity phosphatase active toward substrates containing either phosphotyrosine or phosphoserine residues. Dephosphorylates CDK2 at 'Thr-160' in a cyclin-dependent manner.

Involvement in disease : Hepatocellular carcinoma (HCC)

Subcellular location : Cytoplasm, perinuclear region

Protein Families : Protein-tyrosine phosphatase family

Tissue Specificity :

Paythway :

Uniprot ID : Q16667