Recombinant Human Cystatin-B (CSTB)

Product Description

Recombinant Human Cystatin-B (CSTB) is available at Gentaur for Next week Delivery.

Gene Name: CSTB

Alternative Names : CPI-BLiver thiol proteinase inhibitorStefin-B

Expression Region : 1-98aa

AA Sequence : MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 38.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.

Function : This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.

Involvement in disease : Epilepsy, progressive myoclonic 1 (EPM1)

Subcellular location : Cytoplasm, Nucleus

Protein Families : Cystatin family

Tissue Specificity :

Paythway :

Uniprot ID : P04080