Product Description
Recombinant Human Cysteine-rich hydrophobic domain 2 protein (CHIC2) is available at Gentaur for Next week Delivery.
Gene Name: CHIC2
Alternative Names : BrX-like translocated in leukemia
Expression Region : 1-165aa
AA Sequence : MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 46.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease : A chromosomal aberration involving CHIC2 is found in a form of acute myeloid leukemia (AML). Translocation t(4;12)(q12;p13) with ETV6.
Subcellular location : Cell membrane, Cytoplasmic vesicle
Protein Families : CHIC family
Tissue Specificity :
Paythway :
Uniprot ID : Q9UKJ5
Euro
British Pound
US Dollar