Euro
British Pound
US Dollar
Product Description
Recombinant Human Cysteine-rich protein 1 (CRIP1) is available at Gentaur for Next week Delivery.
Gene Name: CRIP1
Alternative Names : Cysteine-rich heart protein
Expression Region : 1-77aa
AA Sequence : PKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 35.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.
Function : Seems to have a role in zinc absorption and may function as an intracellular zinc transport protein.
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P50238
