Product Description
Recombinant Human Cytochrome b-245 heavy chain (CYBB), partial is available at Gentaur for Next week Delivery.
Gene Name: CYBB
Alternative Names : CGD91-phoxCytochrome b(558) subunit beta;Cytochrome b558 subunit betaHeme-binding membrane glycoprotein gp91phoxNADPH oxidase 2Neutrophil cytochrome b 91KDA polypeptide;Superoxide-generating NADPH oxidase heavy chain subunitgp91-1gp91-phoxp22 phagocyte B-cytochrome
Expression Region : 283-570aa
AA Sequence : ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
Sequence Info : Cytoplasmic Domain
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 49.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Critical component of the mbrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from Cytoplasmic domain NADPH across the plasma mbrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H+ currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
Function : Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc.
Involvement in disease : Granulomatous disease, chronic, X-linked (CGD); Immunodeficiency 34 (IMD34)
Subcellular location : Cell membrane, Multi-pass membrane protein
Protein Families :
Tissue Specificity : Detected in neutrophils (at protein level).
Paythway : HIF-1signalingpathway
Uniprot ID : P04839