Product Description
Recombinant Human Cytochrome b-c1 complex subunit 10 protein (UQCR11) is available at Gentaur for Next week Delivery.
Gene Name: UQCR11
Alternative Names : Complex III subunit 10Complex III subunit XIUbiquinol-cytochrome c reductase complex 6.4KDA protein
Expression Region : 1-56aa
AA Sequence : MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 33.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.This protein may be closely linked to the iron-sulfur protein in the complex and function as an iron-sulfur protein binding factor.
Function : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain.; FUNCTION
Involvement in disease :
Subcellular location : Mitochondrion inner membrane
Protein Families : UQCR11/QCR10 family
Tissue Specificity :
Paythway : Cardiacmusclecontraction
Uniprot ID : O14957
Euro
British Pound
US Dollar