Product Description
Recombinant Human Cytochrome b-c1 complex subunit 8 (UQCRQ), partial is available at Gentaur for Next week Delivery.
Gene Name: UQCRQ
Alternative Names : Complex III subunit omplex III subunit VIIIUbiquinol-cytochrome c reductase complex 9.5KDA proteinUbiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C
Expression Region : 2-78aa
AA Sequence : GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 36.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Function : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.
Involvement in disease : Mitochondrial complex III deficiency, nuclear 4 (MC3DN4)
Subcellular location : Mitochondrion inner membrane
Protein Families : UQCRQ/QCR8 family
Tissue Specificity :
Paythway : Cardiacmusclecontraction
Uniprot ID : O14949
Euro
British Pound
US Dollar