Recombinant Human Cytochrome b-c1 complex subunit 8 (UQCRQ), partial

Product Description

Recombinant Human Cytochrome b-c1 complex subunit 8 (UQCRQ), partial is available at Gentaur for Next week Delivery.

Gene Name: UQCRQ

Alternative Names : Complex III subunit omplex III subunit VIIIUbiquinol-cytochrome c reductase complex 9.5KDA proteinUbiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C

Expression Region : 2-78aa

AA Sequence : GREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 36.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.

Function : This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.

Involvement in disease : Mitochondrial complex III deficiency, nuclear 4 (MC3DN4)

Subcellular location : Mitochondrion inner membrane

Protein Families : UQCRQ/QCR8 family

Tissue Specificity :

Paythway : Cardiacmusclecontraction

Uniprot ID : O14949