Euro
British Pound
US Dollar
Product Description
Recombinant Human Cytochrome c oxidase assembly protein 1 homolog (COA1), partial is available at Gentaur for Next week Delivery.
Gene Name: COA1
Alternative Names : Mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein of 15KDA
Expression Region : 38-146aa
AA Sequence : QKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 39.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Component of some MITRAC complex, a cytochrome c oxidase (COX) assbly intermediate complex that regulates COX assbly. MITRAC complexes regulate both translation of mitochondrial encoded components and assbly of nuclear-encoded components imported in mitochondrion. Required for assbly of mitochondrial respiratory chain complex I and complex IV.
Function : Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly. MITRAC complexes regulate both translation of mitochondrial encoded components and assembly of nuclear-encoded components imported in mitochondrion. Required for assembly of mitochondrial respiratory chain complex I and complex IV.
Involvement in disease :
Subcellular location : Mitochondrion inner membrane, Single-pass membrane protein
Protein Families : COA1 family
Tissue Specificity :
Paythway :
Uniprot ID : Q9GZY4
