Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial (COX7A2L)

Product Description

Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial (COX7A2L) is available at Gentaur for Next week Delivery.

Gene Name: COX7A2L

Alternative Names : COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1

Expression Region : 1-114aa

AA Sequence : MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 39.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the regulation of oxidative phosphorylation and energy metabolism. Necessary for the assembly of mitochondrial respiratory supercomplex

Function : Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity). Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity).

Involvement in disease :

Subcellular location : Mitochondrion inner membrane

Protein Families : Cytochrome c oxidase VIIa family

Tissue Specificity :

Paythway : Cardiacmusclecontraction

Uniprot ID : O14548