Product Description
Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial (COX7A2L) is available at Gentaur for Next week Delivery.
Gene Name: COX7A2L
Alternative Names : COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1
Expression Region : 1-114aa
AA Sequence : MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 39.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in the regulation of oxidative phosphorylation and energy metabolism. Necessary for the assembly of mitochondrial respiratory supercomplex
Function : Involved in the regulation of oxidative phosphorylation and energy metabolism (By similarity). Necessary for the assembly of mitochondrial respiratory supercomplex (By similarity).
Involvement in disease :
Subcellular location : Mitochondrion inner membrane
Protein Families : Cytochrome c oxidase VIIa family
Tissue Specificity :
Paythway : Cardiacmusclecontraction
Uniprot ID : O14548
 Euro
 Euro
             British Pound
 British Pound
             US Dollar
 US Dollar
             
             
                 
       
           
           
           
           
          