Recombinant Human Cytochrome c-type heme lyase (HCCS)

Product Description

Recombinant Human Cytochrome c-type heme lyase (HCCS) is available at Gentaur for Next week Delivery.

Gene Name: HCCS

Alternative Names : Holocytochrome c-type synthase

Expression Region : 1-268aa

AA Sequence : MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 57.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Links covalently the heme group to the apoprotein of cytochrome c.

Function : Links covalently the heme group to the apoprotein of cytochrome c.

Involvement in disease : Linear skin defects with multiple congenital anomalies 1 (LSDMCA1)

Subcellular location : Mitochondrion inner membrane, Membrane, Lipid-anchor

Protein Families : Cytochrome c-type heme lyase family

Tissue Specificity :

Paythway :

Uniprot ID : P53701