Product Description
Recombinant Human Cytoglobin (CYGB) is available at Gentaur for Next week Delivery.
Gene Name: CYGB
Alternative Names : Histoglobin;HGbStellate cell activation-associated protein
Expression Region : 1-190aa
AA Sequence : MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 37.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.
Function : May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Globin family
Tissue Specificity : Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine.
Paythway :
Uniprot ID : Q8WWM9
Euro
British Pound
US Dollar