Recombinant Human Cytoglobin (CYGB)

Product Description

Recombinant Human Cytoglobin (CYGB) is available at Gentaur for Next week Delivery.

Gene Name: CYGB

Alternative Names : Histoglobin;HGbStellate cell activation-associated protein

Expression Region : 1-190aa

AA Sequence : MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 37.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.

Function : May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Globin family

Tissue Specificity : Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine.

Paythway :

Uniprot ID : Q8WWM9