Recombinant Human cytomegalovirus 65KDA phosphoprotein (UL83), partial

Product Description

Recombinant Human cytomegalovirus 65KDA phosphoprotein (UL83), partial is available at Gentaur for Next week Delivery.

Gene Name: UL83

Alternative Names : 65KDA matrix phosphoprotein Phosphoprotein UL83 Tegument protein UL83

Expression Region : 351-480

AA Sequence : FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 18.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Microbiology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Counteracts the host antiviral immune response when activated and phosphorylated, by preventing IRF3 from entering the nucleus. Also participates in the transactivation of viral major immediate-early genes by the recruitment of host IFI16 to the promoters pf these genes.

Function : Counteracts the host antiviral immune response when activated and phosphorylated, by preventing IRF3 from entering the nucleus. Also participates in the transactivation of viral major immediate-early genes by the recruitment of host IFI16 to the promoters pf these genes.

Involvement in disease :

Subcellular location : Virion tegument, Host nucleus, Host cytoplasm

Protein Families : Herpesviridae pp65 family

Tissue Specificity :

Paythway :

Uniprot ID : P06725