Product Description
Recombinant Human cytomegalovirus Envelope glycoprotein L (gL) is available at Gentaur for Next week Delivery.
Gene Name: gL
Alternative Names :
Expression Region : 31-278aa
AA Sequence : AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-GST-tagged
Theoretical MW : 57.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Microbiology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL (By similarity).
Function : The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH.
Involvement in disease :
Subcellular location : Virion membrane, Peripheral membrane protein, Extracellular side, Host cell membrane, Peripheral membrane protein, Extracellular side, Host Golgi apparatus, host trans-Golgi network
Protein Families : Herpesviridae glycoprotein L family
Tissue Specificity :
Paythway :
Uniprot ID : F5HCH8
Euro
British Pound
US Dollar