Recombinant Human DNA-directed RNA polymerase I subunit RPA12 (ZNRD1)

Product Description

Recombinant Human DNA-directed RNA polymerase I subunit RPA12 (ZNRD1) is available at Gentaur for Next week Delivery.

Gene Name: ZNRD1

Alternative Names : Zinc ribbon domain-containing protein 1

Expression Region : 1-126aa

AA Sequence : MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 29.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transcription

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.

Function : DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors.

Involvement in disease :

Subcellular location : Nucleus, nucleolus

Protein Families : Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family

Tissue Specificity :

Paythway :

Uniprot ID : Q9P1U0