Recombinant Human DNA-directed RNA polymerases I and III subunit RPAC2 (POLR1D)

Product Description

Recombinant Human DNA-directed RNA polymerases I and III subunit RPAC2 (POLR1D) is available at Gentaur for Next week Delivery.

Gene Name: POLR1D

Alternative Names : AC19 DNA-directed RNA polymerase I subunit D RNA polymerase I 16KDA subunit

Expression Region : 1-133aa

AA Sequence : MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 42.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q9Y2S0