Recombinant Human DNA fragmentation factor subunit alpha (DFFA)

Product Description

Recombinant Human DNA fragmentation factor subunit alpha (DFFA) is available at Gentaur for Next week Delivery.

Gene Name: DFFA

Alternative Names : DNA fragmentation factor 45KDA subunit

Expression Region : 1-331aa

AA Sequence : MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

Sequence Info : Full Length of BC007721

Tag Info : N-terminal GST-tagged

Theoretical MW : 63.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Inhibitor of the caspase-activated DNase (DFF40).

Function : Inhibitor of the caspase-activated DNase (DFF40).

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families :

Tissue Specificity :

Paythway : Apoptosis

Uniprot ID : O00273