Product Description
Recombinant Human DNA fragmentation factor subunit alpha (DFFA) is available at Gentaur for Next week Delivery.
Gene Name: DFFA
Alternative Names : DNA fragmentation factor 45KDA subunit
Expression Region : 1-331aa
AA Sequence : MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
Sequence Info : Full Length of BC007721
Tag Info : N-terminal GST-tagged
Theoretical MW : 63.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Inhibitor of the caspase-activated DNase (DFF40).
Function : Inhibitor of the caspase-activated DNase (DFF40).
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families :
Tissue Specificity :
Paythway : Apoptosis
Uniprot ID : O00273
Euro
British Pound
US Dollar