Recombinant Human DnaJ homolog subfamily B member 1 (DNAJB1)

Product Description

Recombinant Human DnaJ homolog subfamily B member 1 (DNAJB1) is available at Gentaur for Next week Delivery.

Gene Name: DNAJB1

Alternative Names : DnaJ protein homolog 1Heat shock 40KDA protein 1;HSP40;Heat shock protein 40Human DnaJ protein 1;hDj-1

Expression Region : 1-340aa

AA Sequence : MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 65 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP.

Function : Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Negatively regulates heat shock-induced HSF1 transcriptional activity during the attenuation and recovery phase period of the heat shock response

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus, Nucleus, nucleolus

Protein Families :

Tissue Specificity :

Paythway : Proteinprocessinginendoplasmicreticulum

Uniprot ID : P25685