Recombinant Human Dysbindin domain-containing protein 2 (DBNDD2)

Product Description

Recombinant Human Dysbindin domain-containing protein 2 (DBNDD2) is available at Gentaur for Next week Delivery.

Gene Name: DBNDD2

Alternative Names : Casein kinase-1 binding protein;CK1BPHSMNP1

Expression Region : 1-161aa

AA Sequence : MDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro).

Function : May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro).

Involvement in disease :

Subcellular location :

Protein Families : Dysbindin family

Tissue Specificity : Detected in brain.

Paythway :

Uniprot ID : Q9BQY9