Recombinant Human Echinoderm microtubule-associated protein-like 2 (EML2), partial

Product Description

Recombinant Human Echinoderm microtubule-associated protein-like 2 (EML2), partial is available at Gentaur for Next week Delivery.

Gene Name: EML2

Alternative Names :

Expression Region : 1-418aa

AA Sequence : MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 61.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules.

Function : Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules.

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton, Cytoplasm, cytoskeleton, spindle

Protein Families : WD repeat EMAP family

Tissue Specificity : Ubiquitous.

Paythway :

Uniprot ID : O95834