Product Description
Recombinant Human Echinoderm microtubule-associated protein-like 2 (EML2), partial is available at Gentaur for Next week Delivery.
Gene Name: EML2
Alternative Names :
Expression Region : 1-418aa
AA Sequence : MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 61.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules.
Function : Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules.
Involvement in disease :
Subcellular location : Cytoplasm, cytoskeleton, Cytoplasm, cytoskeleton, spindle
Protein Families : WD repeat EMAP family
Tissue Specificity : Ubiquitous.
Paythway :
Uniprot ID : O95834
Euro
British Pound
US Dollar