Recombinant Human Elafin (PI3)

Product Description

Recombinant Human Elafin (PI3) is available at Gentaur for Next week Delivery.

Gene Name: PI3

Alternative Names : Elastase-specific inhibitor;ESIPeptidase inhibitor 3;PI-3;Protease inhibitor WAP3Skin-derived antileukoproteinase;SKALPWAP four-disulfide core domain protein 14

Expression Region : 61-117aa

AA Sequence : AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.

Function : Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.

Involvement in disease :

Subcellular location : Secreted

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P19957