Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3), partial

Product Description

Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3), partial is available at Gentaur for Next week Delivery.

Gene Name: ERGIC3

Alternative Names : Serologically defined breast cancer antigen NY-BR-84

Expression Region : 47-341aa

AA Sequence : QYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSF

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 49.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Possible role in transport between endoplasmic reticulum and Golgi.

Function : Possible role in transport between endoplasmic reticulum and Golgi.

Involvement in disease :

Subcellular location : Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, Golgi apparatus, cis-Golgi network membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein

Protein Families : ERGIC family

Tissue Specificity :

Paythway :

Uniprot ID : Q9Y282