Product Description
Recombinant Human Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3), partial is available at Gentaur for Next week Delivery.
Gene Name: ERGIC3
Alternative Names : Serologically defined breast cancer antigen NY-BR-84
Expression Region : 47-341aa
AA Sequence : QYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSF
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 49.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Possible role in transport between endoplasmic reticulum and Golgi.
Function : Possible role in transport between endoplasmic reticulum and Golgi.
Involvement in disease :
Subcellular location : Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, Golgi apparatus, cis-Golgi network membrane, Multi-pass membrane protein, Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families : ERGIC family
Tissue Specificity :
Paythway :
Uniprot ID : Q9Y282
Euro
British Pound
US Dollar