Product Description
Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29), partial is available at Gentaur for Next week Delivery.
Gene Name: ERP29
Alternative Names : Endoplasmic reticulum resident protein 28;ERp28Endoplasmic reticulum resident protein 31;ERp31
Expression Region : 40-251aa
AA Sequence : PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 51 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Does not se to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
Function : Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
Involvement in disease :
Subcellular location : Endoplasmic reticulum lumen, Melanosome
Protein Families :
Tissue Specificity : Ubiquitous. Mostly expressed in secretory tissues.
Paythway : Proteinprocessinginendoplasmicreticulum
Uniprot ID : P30040
Euro
British Pound
US Dollar