Recombinant Human Endothelial cell-selective adhesion molecule (ESAM), partial

Product Description

Recombinant Human Endothelial cell-selective adhesion molecule (ESAM), partial is available at Gentaur for Next week Delivery.

Gene Name: ESAM

Alternative Names :

Expression Region : 30-248aa

AA Sequence : QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAA

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 39.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Adhesion

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Can mediate aggregation most likely through a homophilic molecular interaction.

Function : Can mediate aggregation most likely through a homophilic molecular interaction.

Involvement in disease :

Subcellular location : Cell junction, adherens junction, Cell junction, tight junction, Cell membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Highly expressed in endothelial cells.

Paythway : Leukocytetransendothelialmigration

Uniprot ID : Q96AP7