Product Description
Recombinant Human Enhancer of rudimentary homolog (ERH) is available at Gentaur for Next week Delivery.
Gene Name: ERH
Alternative Names :
Expression Region : 2-104aa
AA Sequence : SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 39.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Cycle
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May have a role in the cell cycle.
Function : May have a role in the cell cycle.
Involvement in disease :
Subcellular location :
Protein Families : E(R) family
Tissue Specificity : Expressed in all tissues examined.
Paythway :
Uniprot ID : P84090
Euro
British Pound
US Dollar